AibGenesis™ Mouse Anti-osr2 Antibody (CBMOAB-91027FYA)


Cat: CBMOAB-91027FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-91027FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO91027FYA 100 µg
MO-AB-17383R Monoclonal Cattle (Bos taurus) WB, ELISA MO17383R 100 µg
MO-AB-18348W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18348W 100 µg
MO-AB-60800W Monoclonal Marmoset WB, ELISA MO60800W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO91027FYA
SpecificityThis antibody binds to Zebrafish osr2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish osr2 Antibody is a mouse antibody against osr2. It can be used for osr2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein odd-skipped-related 2; zOsr2; osr
UniProt IDQ567J8
Protein RefseqThe length of the protein is 238 amino acids long.
The sequence is show below: MGSKTLPAPVPLHPAPQLNYSLLRTLNAFPVAVDQLYGLSALHTVQMNRWTVGFPQLQGLADPRFPGALPFPAAAAHLLPHKHPVHRKDRPRFDFANLAVAATQEDPPVTGQSRLSPERRPARGRLPAKSKKEFICRFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHLQTSSLSAAAAAGRCFGATATCGATV.
For Research Use Only | Not For Clinical Use.
Online Inquiry