AibGenesis™ Mouse Anti-ostc Antibody (CBMOAB-91029FYA)


Cat: CBMOAB-91029FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-91029FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO91029FYA 100 µg
MO-AB-04938W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04938W 100 µg
MO-AB-17385R Monoclonal Cattle (Bos taurus) WB, ELISA MO17385R 100 µg
MO-AB-18654W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18654W 100 µg
MO-AB-27683H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27683C 100 µg
MO-AB-32599W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32599W 100 µg
MO-AB-60802W Monoclonal Marmoset WB, ELISA MO60802W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO91029FYA
SpecificityThis antibody binds to Zebrafish ostc.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ostc Antibody is a mouse antibody against ostc. It can be used for ostc detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOligosaccharyltransferase complex subunit ostc; ost
UniProt IDQ7ZWJ3
Protein RefseqThe length of the protein is 149 amino acids long.
The sequence is show below: METLFSLPFTVLECPNVKLKKPSWLHMPSAMTVYAVVIVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVSVLLSFFMARVFMRMKLPGYLMG.
For Research Use Only | Not For Clinical Use.
Online Inquiry