AibGenesis™ Mouse Anti-OTUD6B Antibody (CBMOAB-53670FYA)
Cat: CBMOAB-53670FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-53670FYA | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Goat, Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Ye, Zebrafish (Danio rerio), Yeast, Marmoset | WB, ELISA | MO53670FYA | 100 µg | ||
| CBMOAB-91101FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO91101FYA | 100 µg | ||
| MO-AB-02026W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO02026W | 100 µg | ||
| MO-AB-05920H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05920C | 100 µg | ||
| MO-AB-16574W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16574W | 100 µg | ||
| MO-AB-60816W | Monoclonal | Marmoset | WB, ELISA | MO60816W | 100 µg | ||
| MO-DKB-03546W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Goat, Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Ye, Zebrafish (Danio rerio) | WB | 100 µg | |||
| MO-DKB-03695W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Yeast | WB, ELISA, IHC-P, IHC-Fr, IF, ICC | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Goat, Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Ye, Zebrafish (Danio rerio), Yeast, Marmoset |
| Clone | MO53670FYA |
| Specificity | This antibody binds to Rhesus OTUD6B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the ovarian tumor domain (OTU)-containing subfamily of deubiquitinating enzymes. Deubiquitinating enzymes are primarily involved in removing ubiquitin from proteins targeted for degradation. This protein may function as a negative regulator of the cell cycle in B cells. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus OTUD6B Antibody is a mouse antibody against OTUD6B. It can be used for OTUD6B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | OTU domain-containing protein 6B; OTUD6B |
| UniProt ID | H9FVN8 |
| Protein Refseq | The length of the protein is 324 amino acids long. The sequence is show below: MEPRVRVEGWKVPASRWYRFLPALVLGYLVLMEAVLTEELDEEEQLVRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLSGARHMESEKLAQILAARQLEMKQIPSDGHCMYRAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMCTPEEFQKYCDDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPITVGEEYSKHPLILVYMRHAYGLGEHYNSVTRLVNIVTENCS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry