AibGenesis™ Mouse Anti-P2X2 Antibody (MO-AB-27698H)


Cat: MO-AB-27698H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-27698H Monoclonal Rat (Rattus norvegicus), Dog (Canis lupus familiaris) WB, ELISA MO27698C 100 µg
MO-AB-32611W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32611W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Dog (Canis lupus familiaris)
CloneMO27698C
SpecificityThis antibody binds to Rat P2X2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against P2X2. It can be used for P2X2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesP2X2-4 receptor; P2X2
UniProt IDO54869
Protein RefseqThe length of the protein is 186 amino acids long.
The sequence is show below: MVRRLARGCWSAFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWSLQGCLRSRHRPVPQVRLHRAEKLPGQRDRTGELHHHQSQGDHHVGRQSVGRGGIRKAPGGGQCSQHHHQDRGYPFPDLGNMPREHEGSQLYLPFRRRLYCRTAGHARQWDSHRALCTLLPWGLQDLRGVSLVPGGGWNF.
For Research Use Only | Not For Clinical Use.
Online Inquiry