AibGenesis™ Mouse Anti-PAI3 Antibody (CBMOAB-02782CR)


Cat: CBMOAB-02782CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02782CR Monoclonal Yeast, A. thaliana (Arabidopsis thaliana) WB, ELISA MO02782CR 100 µg
Inquiry
CBMOAB-38057FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO38057FC 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, A. thaliana (Arabidopsis thaliana)
CloneMO02782CR
SpecificityThis antibody binds to Yeast PAI3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Vacuole; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSpecific and potent inhibitor for yeast aspartic protease A (yscA). The proteinase acts as a folding template stabilizing the helical conformation in the inhibitor, which results in the potent and specific blockage of the proteolytic activity. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Yeast PAI3 Antibody is a mouse antibody against PAI3. It can be used for PAI3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtease A inhibitor 3; Proteinase inhibitor I(A)3; Proteinase yscA-inhibitor; Saccharopepsin inhibitor; PAI3; YMR174C
UniProt IDP01094
Protein RefseqThe length of the protein is 68 amino acids long. The sequence is show below: MNTDQQKVSEIFQSSKEKLQGDAKVVSDAFKKMASQDKDGKTTDADESEKHNYQEQYNKLKGAGHKKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry