AibGenesis™ Mouse Anti-paqr8 Antibody (CBMOAB-91411FYA)


Cat: CBMOAB-91411FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-91411FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset WB, ELISA MO91411FYA 100 µg
MO-AB-03329Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03329Y 100 µg
MO-AB-06012H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06012C 100 µg
MO-AB-17544R Monoclonal Cattle (Bos taurus) WB, ELISA MO17544R 100 µg
MO-AB-60990W Monoclonal Marmoset WB, ELISA MO60990W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset
CloneMO91411FYA
SpecificityThis antibody binds to Zebrafish paqr8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish paqr8 Antibody is a mouse antibody against paqr8. It can be used for paqr8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMembrane progestin receptor beta; paqr8; mpr
UniProt IDQ801G3
Protein RefseqThe length of the protein is 352 amino acids long.
The sequence is show below: MSSGVLGRLSTLTLSLQQLGQLPHLSNWLPRLPRRQATVHASEVPSLFREPYILSGYRPVHQEWRSYFCSLFQCHNELLNVWTHLLAIPAVLLQFSFFAGAWGLTLNLASLPLFLYVLSSLTYLSFSVAAHLLQSHSELAHYSLFFVDYVGVAVYQYGCSMGHYFYCSEPEWRHSLVGVLFLPGAAMLAWLSCASCCYSKFRYRRPYPFHRKICQIIPTSLAYLLDISPVAHRLLTKSWDEPVLVFHAMQVAFFLLAALFFSCPVPERFFPGRCDIVGHGHQIFHIFLVLCTMCQLEAMFRDFLVHQQSVVDAHGEHFILLAGGSFFLLVLCSILTAVLMRGAVQRQLRKKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry