AibGenesis™ Mouse Anti-PARD6B Antibody (CBMOAB-53889FYA)


Cat: CBMOAB-53889FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53889FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO53889FYA 100 µg
CBMOAB-91427FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91427FYA 100 µg
MO-AB-03330Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03330Y 100 µg
MO-AB-06015H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06015C 100 µg
MO-AB-17549R Monoclonal Cattle (Bos taurus) WB, ELISA MO17549R 100 µg
MO-AB-28128R Monoclonal Pig (Sus scrofa) WB, ELISA MO28128R 100 µg
MO-AB-61005W Monoclonal Marmoset WB, ELISA MO61005W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO53889FYA
SpecificityThis antibody binds to Rhesus PARD6B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain, an OPR domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cytoplasmic protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. (From NCBI)
Product OverviewMouse Anti-Rhesus PARD6B Antibody is a mouse antibody against PARD6B. It can be used for PARD6B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPARD6B
UniProt IDF7F297
Protein RefseqThe length of the protein is 350 amino acids long.
The sequence is show below: FGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDNYHKAXXXXXXIEIILCHKLKEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGSPQHIEPSCEPEDEDSDEDDIIIEDNGVPQQIPKAVPNTESLESLTQIELSFEAGQNGFIPSNEVSLAPIASGSNTEFETHAPDQKLLEEDGTIITL.
For Research Use Only | Not For Clinical Use.
Online Inquiry