AibGenesis™ Mouse Anti-PARP11 Antibody (CBMOAB-53902FYA)


Cat: CBMOAB-53902FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53902FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Marmoset WB, ELISA MO53902FYA 100 µg
MO-AB-06022H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06022C 100 µg
MO-AB-17566R Monoclonal Cattle (Bos taurus) WB, ELISA MO17566R 100 µg
MO-AB-26475W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26475W 100 µg
MO-AB-61018W Monoclonal Marmoset WB, ELISA MO61018W 100 µg
MO-DKB-01235W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Marmoset
CloneMO53902FYA
SpecificityThis antibody binds to Rhesus PARP11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PARP11 Antibody is a mouse antibody against PARP11. It can be used for PARP11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPoly [ADP-ribose] polymerase 11; PARP11
UniProt IDH9FJ11
Protein RefseqThe length of the protein is 189 amino acids long.
The sequence is show below: PDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKATYFA.
For Research Use Only | Not For Clinical Use.
Online Inquiry