AibGenesis™ Mouse Anti-PCDH18 Antibody (CBMOAB-54005FYA)


Cat: CBMOAB-54005FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54005FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset WB, ELISA MO54005FYA 100 µg
MO-AB-06071H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06071C 100 µg
MO-AB-17602R Monoclonal Cattle (Bos taurus) WB, ELISA MO17602R 100 µg
MO-AB-18660W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18660W 100 µg
MO-AB-35379W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35379W 100 µg
MO-AB-61081W Monoclonal Marmoset WB, ELISA MO61081W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset
CloneMO54005FYA
SpecificityThis antibody binds to Rhesus PCDH18.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. This gene encodes a protein which contains 6 extracellular cadherin domains, a transmembrane domain and a cytoplasmic tail differing from those of the classical cadherins. Although its specific function is undetermined, the cadherin-related neuronal receptor is thought to play a role in the establishment and function of specific cell-cell connections in the brain. (From NCBI)
Product OverviewMouse Anti-Rhesus PCDH18 Antibody is a mouse antibody against PCDH18. It can be used for PCDH18 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtocadherin-18; PCDH18
UniProt IDH9FLB8
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: FLTDGRIPAAMRLCTEECRVLGHSDQCWMPPLPSPSSDYRSNMFIPGEEFPTQPQQQHPHQSLEDDAQPADSGEKKKSFSTFGKDSPNDEDTGDTSTSSLLSEMSSVFQRLLPPSLDTYSECSEVDRSNSLERRKGPLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry