AibGenesis™ Mouse Anti-PCMTD2 Antibody (CBMOAB-54038FYA)


Cat: CBMOAB-54038FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54038FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO54038FYA 100 µg
CBMOAB-91868FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO91868FYA 100 µg
MO-AB-06085H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06085C 100 µg
MO-AB-17630R Monoclonal Cattle (Bos taurus) WB, ELISA MO17630R 100 µg
MO-AB-17667W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17667W 100 µg
MO-AB-27760H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27760C 100 µg
MO-AB-28162R Monoclonal Pig (Sus scrofa) WB, ELISA MO28162R 100 µg
MO-AB-61137W Monoclonal Marmoset WB, ELISA MO61137W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO54038FYA
SpecificityThis antibody binds to Rhesus PCMTD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PCMTD2 Antibody is a mouse antibody against PCMTD2. It can be used for PCMTD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPCMTD2
UniProt IDF7H7G3
Protein RefseqThe length of the protein is 282 amino acids long.
The sequence is show below: MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGNIHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNLLKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLIQPCHSESGKSRLVQLRKYTILRSWSAIVCPWLTATSASQAQVILPPQPPEYLGLQAPATTPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry