AibGenesis™ Mouse Anti-PDGFRL Antibody (CBMOAB-54163FYA)


Cat: CBMOAB-54163FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54163FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO54163FYA 100 µg
CBMOAB-92052FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92052FYA 100 µg
MO-AB-03382Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03382Y 100 µg
MO-AB-06129H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06129C 100 µg
MO-AB-17702R Monoclonal Cattle (Bos taurus) WB, ELISA MO17702R 100 µg
MO-AB-19627W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19627W 100 µg
MO-AB-61221W Monoclonal Marmoset WB, ELISA MO61221W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO54163FYA
SpecificityThis antibody binds to Rhesus PDGFRL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and non-small cell lung cancers. This suggests this gene product may function as a tumor suppressor. (From NCBI)
Product OverviewMouse Anti-Rhesus PDGFRL Antibody is a mouse antibody against PDGFRL. It can be used for PDGFRL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPDGFRL
UniProt IDF6RQ55
Protein RefseqThe length of the protein is 375 amino acids long.
The sequence is show below: MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKIKDRDSADSTPKMQSIMMQVLDKGRFQKPAATLSLLAGQSVELRCKGSRIGWSYPAYLDTFKDSRISVKQNERYGQLTLVNSTSADTGEFSCWGQLCSGYICRKDETKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKVTLHREFPAKEIPANGTDIVYDMKRGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASSNKVKSGDDVSVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRLSQSVITVEDFETIDAGYYICTAQNLQGQTTVATTVEFS.
For Research Use Only | Not For Clinical Use.
Online Inquiry