AibGenesis™ Mouse Anti-PDSS1 Antibody (CBMOAB-54209FYA)


Cat: CBMOAB-54209FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54209FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO54209FYA 100 µg
CBMOAB-92129FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92129FYA 100 µg
MO-AB-13801W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13801W 100 µg
MO-AB-17736R Monoclonal Cattle (Bos taurus) WB, ELISA MO17736R 100 µg
MO-AB-61265W Monoclonal Marmoset WB, ELISA MO61265W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO54209FYA
SpecificityThis antibody binds to Rhesus PDSS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in this gene are a cause of coenzyme Q10 deficiency. (From NCBI)
Product OverviewMouse Anti-Rhesus PDSS1 Antibody is a mouse antibody against PDSS1. It can be used for PDSS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPDSS1
UniProt IDF7C4K8
Protein RefseqThe length of the protein is 415 amino acids long.
The sequence is show below: MASRWWRWLRGCSWRPAARSPGPGCPGLAGPRGPQAAADAHAQVHRRKGLHLSQIPYINLVKHLTSACPNVYSISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSELKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNSRHVQASQRTIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVRGEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDK.
For Research Use Only | Not For Clinical Use.
Online Inquiry