AibGenesis™ Mouse Anti-PEBP4 Antibody (CBMOAB-54250FYA)


Cat: CBMOAB-54250FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54250FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa) WB, ELISA MO54250FYA 100 µg
MO-AB-06165H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06165C 100 µg
MO-AB-17754R Monoclonal Cattle (Bos taurus) WB, ELISA MO17754R 100 µg
MO-AB-28201R Monoclonal Pig (Sus scrofa) WB, ELISA MO28201R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa)
CloneMO54250FYA
SpecificityThis antibody binds to Rhesus PEBP4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PEBP4 Antibody is a mouse antibody against PEBP4. It can be used for PEBP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPEBP4
UniProt IDF7H656
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MGWTMRLVTAALLLGLVMVITGDEDENNPCAQEALLDEDALVCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMAPIVKFPGAVEGATYILLMVDPDAPSRAEPTQKFWRHWLVTDIEGADLKKGKIQGQELSAYQAPSPPAHSGFHRYQFFVYLQEGKVISLLPKENKTRGSWNMGIFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRGGASKPKHNQVEIAAC.
For Research Use Only | Not For Clinical Use.
Online Inquiry