AibGenesis™ Mouse Anti-petC Antibody (CBMOAB-88559FYB)


Cat: CBMOAB-88559FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88559FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Cucumber (Cucumis sativus), Soybean (Glycine max) WB, ELISA MO88559FYB 100 µg
CBMOAB-38630FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO38630FC 100 µg
MO-AB-28580W Monoclonal Cucumber (Cucumis sativus) WB, ELISA MO28580W 100 µg
MO-AB-32174H Monoclonal Soybean (Glycine max) WB, ELISA MO32174C 100 µg
MO-DKB-01629W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Cucumber (Cucumis sativus), Soybean (Glycine max)
CloneMO88559FYB
SpecificityThis antibody binds to Rice petC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Chloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice petC Antibody is a mouse antibody against petC. It can be used for petC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b6-f complex iron-sulfur subunit, chloroplastic; EC 1.10.9.1; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; Rieske iron-sulfur protein; ISP; RISP; petC; Os07g0556200 LOC_Os07g37030
UniProt IDQ69S39
Protein RefseqThe length of the protein is 225 amino acids long.
The sequence is show below: MASTALSTASNPTQLCRSRASLGKPVKGLGFGRERVPRTATTITCQAASSIPADRVPDMGKRQLMNLLLLGAISLPTVGMLVPYGAFFIPAGSGNAGGGQVAKDKLGNDVLAEEWLKTHGPNDRTLTQGLKGDPTYLVVEADKTLATYGINAVCTHLGCVVPWNAAENKFICPCHGSQYNNQGRVVRGPAPLSLALVHADVDDGKVLFVPWVETDFRTGDNPWWA.
For Research Use Only | Not For Clinical Use.
Online Inquiry