AibGenesis™ Mouse Anti-PETL Antibody (CBMOAB-38635FYC)
Cat: CBMOAB-38635FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-38635FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) | WB, ELISA | MO38635FC | 100 µg | ||
| CBMOAB-88564FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88564FYB | 100 µg | ||
| MO-AB-00469W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00469W | 100 µg | ||
| MO-AB-01898L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01898L | 100 µg | ||
| MO-AB-30478H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30478C | 100 µg | ||
| MO-AB-39371W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39371W | 100 µg | ||
| MO-DKB-02710W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO38635FC |
| Specificity | This antibody binds to Arabidopsis PETL. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetL is important for photoautotrophic growth as well as for electron transfer efficiency and stability of the cytochrome b6-f complex. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Arabidopsis PETL Antibody is a mouse antibody against PETL. It can be used for PETL detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome b6-f complex subunit 6; Cytochrome b6-f complex subunit PetL; Cytochrome b6-f complex subunit VI; petL; AtCg00590 |
| UniProt ID | P56776 |
| Protein Refseq | The length of the protein is 31 amino acids long. The sequence is show below: MLTITSYFGFLLAALTITSVLFIGLSKIRLI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry