Mouse Anti-Pig ABCA12 Antibody (MO-AB-23440R)


Cat: MO-AB-23440R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23440R
SpecificityThis antibody binds to Pig ABCA12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily, which is the only major ABC subfamily found exclusively in multicellular eukaryotes. Alternative splicing of this gene results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against ABCA12. It can be used for ABCA12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette transporter 12 variant 1; ATP-binding cassette transporter 12 variant 2, Fragment; ABCA12
UniProt IDW8FMP4
Protein RefseqThe length of the protein is 30 amino acids long.
The sequence is show below: MEECEALCTRLAIMVNGRFQCIGSLQHIKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry