Mouse Anti-Pig ABCA12 Antibody (MO-AB-23440R)
Cat: MO-AB-23440R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO23440R |
Specificity | This antibody binds to Pig ABCA12. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily, which is the only major ABC subfamily found exclusively in multicellular eukaryotes. Alternative splicing of this gene results in multiple transcript variants. |
Product Overview | This product is a mouse antibody against ABCA12. It can be used for ABCA12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-binding cassette transporter 12 variant 1; ATP-binding cassette transporter 12 variant 2, Fragment; ABCA12 |
UniProt ID | W8FMP4 |
Protein Refseq | The length of the protein is 30 amino acids long. The sequence is show below: MEECEALCTRLAIMVNGRFQCIGSLQHIKS. |
See other products for " ABCA12 "
CBMOAB-1252FYC | Mouse Anti-Arabidopsis ABCA12 Antibody (CBMOAB-1252FYC) |
MO-AB-00859W | Mouse Anti-Rhesus ABCA12 Antibody (MO-AB-00859W) |
CBMOAB-64324FYA | Mouse Anti-Zebrafish abca12 Antibody (CBMOAB-64324FYA) |
CBMOAB-34774FYA | Mouse Anti-Rhesus ABCA12 Antibody (CBMOAB-34774FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry