Mouse Anti-Pig April Antibody (MO-AB-23832R)


Cat: MO-AB-23832R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO23832R
SpecificityThis antibody binds to Pig April.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAPRIL (proliferation-inducing ligand) is a member of the TNF superfamily found in humans and mice. The two receptors for APRIL are named TACI and BCMA. APRIL stimulates B and T cell proliferation, triggers humoral immune responses, activates NF-kB, and induces cell death. APRIL and its receptors BCMA and TACI have been implicated in autoimmunity and cancer.
Product OverviewThis product is a mouse antibody against April. It can be used for April detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesA proliferation-inducing ligand; April
UniProt IDA9Q6C0
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: MPASSPSLPAPKGPLGDMAPIREPARSVALWLSWGAALGAVACAMVLLTQQTELQTLRREVTRLQRTGGPSEKGEGDPWQNLWEQEQSPDGAEAWENGERSRRRRAVLTRKQKKKRSVLHLVPTNITSKEDSDVTELMWQPALKRGRGLEAQGYFVRVWDAGVYLLYSQVLFHDVTFTMGQVVSREGQGRQETLFRCIRSMPSNPDWAYNSCYSAGVFHLHQGDILSVVIPRARAKLSLSPHGTFLGVVKL.
See other products for " APRIL "
MOFAB-101WRabbit Anti-APRIL Antibody (MOFAB-101W)
MO-AB-10645YMouse Anti-O. mykiss APRIL Antibody (MO-AB-10645Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry