Mouse Anti-Pig DBI Antibody (MO-AB-25303R)
Cat: MO-AB-25303R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO25303R |
Specificity | This antibody binds to Pig DBI. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. |
Product Overview | This product is a mouse antibody against DBI. It can be used for DBI detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Diazepam binding inhibitor, Fragment; DBI |
UniProt ID | Q9GJX2 |
Protein Refseq | The length of the protein is 78 amino acids long. The sequence is show below: MSQAEFEKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKV. |
See other products for " dbi "
MO-AB-02869H | Mouse Anti-Frog dbi Antibody (MO-AB-02869H) |
MO-AB-23123H | Mouse Anti-Mallard DBI Antibody (MO-AB-23123H) |
MO-AB-30108W | Mouse Anti-Dog DBI Antibody (MO-AB-30108W) |
MO-AB-01552Y | Mouse Anti-Chicken DBI Antibody (MO-AB-01552Y) |
CBMOAB-14624FYA | Mouse Anti-D. melanogaster Dbi Antibody (CBMOAB-14624FYA) |
MO-AB-53927W | Mouse Anti-Marmoset DBI Antibody (MO-AB-53927W) |
MO-AB-01840W | Mouse Anti-Rhesus DBI Antibody (MO-AB-01840W) |
MO-AB-26488W | Mouse Anti-Chimpanzee DBI Antibody (MO-AB-26488W) |
CBMOAB-40420FYA | Mouse Anti-Rhesus DBI Antibody (CBMOAB-40420FYA) |
MO-AB-24358W | Mouse Anti-Chimpanzee DBI Antibody (MO-AB-24358W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry