Mouse Anti-Pig DGAT2 Antibody (MO-AB-25361R)


Cat: MO-AB-25361R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO25361R
SpecificityThis antibody binds to Pig DGAT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against DGAT2. It can be used for DGAT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDiacylglycerol acytransferase 2; DGAT2
UniProt IDI1SNT8
Protein RefseqThe length of the protein is 362 amino acids long.
The sequence is show below: MKTLIAAYSGVLRGSPGSSILSALQDLSAITWLNRSKVEKQLQVISVLQWVLSFLVLGVACSVILVYLICTDCWLITALYFTWLAFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIKPYLATLAGNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPTYSFGENEVYQQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLMPYSKPITTVVGEPITIPKLEHPTQQDIDLYHAMYTEALVKLFNQHKTKFGLPETEVLEVN.
See other products for " dgat2 "
CBMOAB-73391FYAMouse Anti-Zebrafish dgat2 Antibody (CBMOAB-73391FYA)
MO-AB-54127WMouse Anti-Marmoset DGAT2 Antibody (MO-AB-54127W)
CBMOAB-27453FYCMouse Anti-Arabidopsis DGAT2 Antibody (CBMOAB-27453FYC)
CBMOAB-02627HCBMouse Anti-C. elegans DGAT2 Antibody (CBMOAB-02627HCB)
MO-AB-19545WMouse Anti-Chimpanzee DGAT2 Antibody (MO-AB-19545W)
MO-AB-37131WMouse Anti-Goat DGAT2 Antibody (MO-AB-37131W)
MO-AB-23136HMouse Anti-Mallard dgat2 Antibody (MO-AB-23136H)
MO-AB-01874WMouse Anti-Rhesus DGAT2 Antibody (MO-AB-01874W)
MO-AB-11390RMouse Anti-Cattle DGAT2 Antibody (MO-AB-11390R)
For Research Use Only | Not For Clinical Use.
Online Inquiry