Mouse Anti-Zebrafish dgat2 Antibody (CBMOAB-73391FYA)


Cat: CBMOAB-73391FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO73391FYA
SpecificityThis antibody binds to Zebrafish dgat2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish dgat2 Antibody is a mouse antibody against dgat2. It can be used for dgat2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDiacylglycerol O-acyltransferase 2; dgat
UniProt IDF1Q578
Protein RefseqThe length of the protein is 366 amino acids long.
The sequence is show below: MKTILAAYSGVKKGSGSSILSALHDLPTVPWLTRSKMVKHLQVISVLQFIMTFLTMGIACSLLLMYMFCTDFWVISVLYVAWLIYDWNTPGQDIFISGGRRSTWVRDWTVWKYMRDYFPIRLIKTHNLLPSRNYIFGYHPHGILCFGAFCNFGTEATGFTKVFPGIKPSLATLAGNFRLPMFREYLMCGGICPVNRNSIDYLLSSNGTGNAVVIVIGGAAESLDCAPGRNSVMLKKRKGFVKLALKQGADLVPVYSFGENEVYKQLIFEEGSWWRTIQRKLQKFLGFAPCLFHGCGLFFPESWGLVPYCKPITTVVGEPITVPKIEEPTQDVIDMYHAMYIRSLKSLFDNYKTRFGLNESDTLIIH.
For Research Use Only | Not For Clinical Use.
Online Inquiry