Mouse Anti-Pig ERCC1 Antibody (MO-AB-25703R)


Cat: MO-AB-25703R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO25703R
SpecificityThis antibody binds to Pig ERCC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5'' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand.
Product OverviewThis product is a mouse antibody against ERCC1. It can be used for ERCC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesExcision repair cross-complementing rodent repair deficiency complementation group 1; ERCC1
UniProt IDC1JEY0
Protein RefseqThe length of the protein is 294 amino acids long.
The sequence is show below: MDEEGGQKPAASPTRKKFVIPLDEDEVPPPGAKPLFKCTRSLPTVETPPQPAPQTYAEYAISGPPGGAGATHPTGPEPLAGETPNQAPKPGAKSNSIIVSPRQRGNPVLRFVRNVPWQFGDVLPDYVLGQSTCALFLSLRYHNLHPDYIHQRLQSLGKSFALRVLLVQVDVKDPQQALRDLAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLTAASREDLALCPGLGPQKARRLFDVLHEPFLKASR.
For Research Use Only | Not For Clinical Use.
Online Inquiry