Mouse Anti-Pig GRM4 Antibody (MO-AB-26230R)
Cat: MO-AB-26230R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO26230R |
Specificity | This antibody binds to Pig GRM4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Several transcript variants encoding different isoforms have been found for this gene. |
Product Overview | This product is a mouse antibody against GRM4. It can be used for GRM4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Glutamate receptor metabotropic 4, Fragment; GRM4 |
UniProt ID | D5KRL3 |
Protein Refseq | The length of the protein is 82 amino acids long. The sequence is show below: LYIQTTTLTVSVSLSASVSLGMLYMPKVYVILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGSFRPNGEAKSELCENLEAP. |
See other products for " GRM4 "
MO-AB-56405W | Mouse Anti-Marmoset GRM4 Antibody (MO-AB-56405W) |
MO-AB-21463W | Mouse Anti-Chimpanzee GRM4 Antibody (MO-AB-21463W) |
CBMOAB-63961FYA | Mouse Anti-Zebrafish grm4 Antibody (CBMOAB-63961FYA) |
CBMOAB-44152FYA | Mouse Anti-Rhesus GRM4 Antibody (CBMOAB-44152FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry