Mouse Anti-Pig HTRA4 Antibody (MO-AB-26423R)
Cat: MO-AB-26423R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO26423R |
Specificity | This antibody binds to Pig HTRA4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the HtrA family of proteases. The encoded protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging. |
Product Overview | This product is a mouse antibody against HTRA4. It can be used for HTRA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | HtrA serine peptidase 4, Fragment; HTRA4 |
UniProt ID | C7C1J1 |
Protein Refseq | The length of the protein is 30 amino acids long. The sequence is show below: DVIVSINGQPVSTTTDVIEAVKANDFLSIL. |
See other products for " HTRA4 "
MO-AB-13909R | Mouse Anti-Cattle HTRA4 Antibody (MO-AB-13909R) |
CBMOAB-44944FYA | Mouse Anti-Rhesus HTRA4 Antibody (CBMOAB-44944FYA) |
MO-AB-57057W | Mouse Anti-Marmoset HTRA4 Antibody (MO-AB-57057W) |
CBMOAB-63983FYA | Mouse Anti-Zebrafish htra4 Antibody (CBMOAB-63983FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry