Mouse Anti-Rhesus HTRA4 Antibody (CBMOAB-44944FYA)


Cat: CBMOAB-44944FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO44944FYA
SpecificityThis antibody binds to Rhesus HTRA4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the HtrA family of proteases. The encoded protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.
Product OverviewMouse Anti-Rhesus HTRA4 Antibody is a mouse antibody against HTRA4. It can be used for HTRA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHTRA4
UniProt IDF6WIZ9
Protein RefseqThe length of the protein is 479 amino acids long.
The sequence is show below: MIRPQLRPAGLGRCLLPGLLLLLVPVLWAGAARLHTQLACPAVCQPTRCPALPTCSLGTTPVLDLCRCCRVCPAAEGQVCGGTQGQPCAPGLQCLKPLRPGLPSTCGCPTKGVAVCGSDRRTYPSLCALRTENRAARRLGNISAVPVQWGDCGDTGSRRAGTLRRNYNFIAAVVEKVAPSVVHMQLWGRLLHGRMPVPVYSGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIEPNADLPVLMLGRSSDLRAGEFVVALGSPVSLQNTATAGIVSTKQRKGKELGMKDSDIDYVQIDAAINPGNSGGPLVNLDGDVVGVNSLRVTEGISFAIPSDRVRPFLEEYHKRQLTGKARMVFSNKKYLGLQMLPLTMPLSKELKIHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVKINGKPITTTTDVLEALDSDSLSMAVLRGKDNLLLTVIPEVIN.
For Research Use Only | Not For Clinical Use.
Online Inquiry