Mouse Anti-Pig MCM7 Antibody (MO-AB-27223R)
Cat: MO-AB-27223R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Pig (Sus scrofa) |
| Clone | MO27223R |
| Specificity | This antibody binds to Pig MCM7. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Acts as component of the mcm2-7 complex (mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. |
| Product Overview | This product is a mouse antibody against MCM7. It can be used for MCM7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | P1 Mcm3 protein, Fragment |
| UniProt ID | Q29339 |
| Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: KPRVIREVRXDSVGKLVTVRGIVTRVSXVKPRMVVATYTCXQCGAETYQPIQSPTFMPLIMCPSQGVPDPTRFRRGADL. |
See other products for " MCM7 "
| MO-AB-13905Y | Mouse Anti-Sea-anemone MCM7 Antibody (MO-AB-13905Y) |
| CBMOAB-86322FYA | Mouse Anti-Zebrafish mcm7 Antibody (CBMOAB-86322FYA) |
| MO-AB-15464R | Mouse Anti-Cattle MCM7 Antibody (MO-AB-15464R) |
| CBMOAB-36310FYC | Mouse Anti-Arabidopsis MCM7 Antibody (CBMOAB-36310FYC) |
| MO-AB-43253W | Mouse Anti-Hamsters MCM7 Antibody (MO-AB-43253W) |
| MO-AB-12589W | Mouse Anti-Chimpanzee MCM7 Antibody (MO-AB-12589W) |
| MO-AB-58865W | Mouse Anti-Marmoset MCM7 Antibody (MO-AB-58865W) |
| MO-AB-23418H | Mouse Anti-Mallard MCM7 Antibody (MO-AB-23418H) |
| MO-AB-27798W | Mouse Anti-Cottonwood MCM7 Antibody (MO-AB-27798W) |
| CBMOAB-23522FYA | Mouse Anti-D. melanogaster Mcm7 Antibody (CBMOAB-23522FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry