Mouse Anti-Cattle MCM7 Antibody (MO-AB-15464R)


Cat: MO-AB-15464R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15464R
SpecificityThis antibody binds to Cattle MCM7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1 / RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product OverviewMouse Anti-Cattle MCM7 Antibody is a mouse antibody against MCM7. It can be used for MCM7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNA replication licensing factor MCM7; EC 3.6.4.12; MCM7
UniProt IDQ3ZBH9
Protein RefseqThe length of the protein is 719 amino acids long.
The sequence is show below: MALKDYVLEKDKVKKFLQEFYQDDESGKKQFKYGNQLVQLAHREQVAMYVDLDDIAEDDPELVDSICENTKRYARLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGAARSPQNQYPPELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPRMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFIKFQEMKMQEHSDQVPVGNIPRSITV.
For Research Use Only | Not For Clinical Use.
Online Inquiry