Mouse Anti-Barrel medic MCM7 Antibody (MO-AB-00315W)
Cat: MO-AB-00315W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Barrel medic (Medicago truncatula) |
Clone | MO00315W |
Specificity | This antibody binds to Barrel medic MCM7. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Product Overview | Mouse Anti-Barrel medic MCM7 Antibody is a mouse antibody against MCM7. It can be used for MCM7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Minichromosome maintenance (MCM2 / 3 / 5) family protein, putative; MTR_8g005255 |
UniProt ID | A0A072TW89 |
Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: MTRSCPSVLEDSTRSLKLIDARAYISTVRRLSPTVPGELEEYIANAYSNIRQEEAKSTTPHSYTTIRTLLSILRISVEQVLGYDEAEEE. |
See other products for " mcm7 "
CBMOAB-86322FYA | Mouse Anti-Zebrafish mcm7 Antibody (CBMOAB-86322FYA) |
MO-AB-70041W | Mouse Anti-Silkworm MCM7 Antibody (MO-AB-70041W) |
MO-AB-13905Y | Mouse Anti-Sea-anemone MCM7 Antibody (MO-AB-13905Y) |
MO-AB-15464R | Mouse Anti-Cattle MCM7 Antibody (MO-AB-15464R) |
CBMOAB-36310FYC | Mouse Anti-Arabidopsis MCM7 Antibody (CBMOAB-36310FYC) |
CBMOAB-02184CR | Mouse Anti-Yeast MCM7 Antibody (CBMOAB-02184CR) |
CBMOAB-23522FYA | Mouse Anti-D. melanogaster Mcm7 Antibody (CBMOAB-23522FYA) |
MO-AB-48694W | Mouse Anti-Maize MCM7 Antibody (MO-AB-48694W) |
MO-AB-27223R | Mouse Anti-Pig MCM7 Antibody (MO-AB-27223R) |
MO-AB-27798W | Mouse Anti-Cottonwood MCM7 Antibody (MO-AB-27798W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry