Mouse Anti-Pig MYD88 Antibody (MO-AB-27438R)
Cat: MO-AB-27438R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO27438R |
Specificity | This antibody binds to Pig MYD88. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010] |
Product Overview | This product is a mouse antibody against MYD88. It can be used for MYD88 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Myeloid differentiation primary response gene 88, Fragment; MYD88 |
UniProt ID | Q6T5D4 |
Protein Refseq | The length of the protein is 42 amino acids long. The sequence is show below: ALSLSPGAHQKRLIPVKYKSMKKEFPSILRFITVCDYTNPCT. |
See other products for " MYD88 "
MO-AB-12134Y | Mouse Anti-O. mykiss MYD88 Antibody (MO-AB-12134Y) |
MO-AB-35158W | Mouse Anti-Ferret MYD88 Antibody (MO-AB-35158W) |
MO-AB-00943R | Mouse Anti-Medaka myd88 Antibody (MO-AB-00943R) |
CBMOAB-87971FYA | Mouse Anti-Zebrafish myd88 Antibody (CBMOAB-87971FYA) |
MO-AB-37733W | Mouse Anti-Goat myd88 Antibody (MO-AB-37733W) |
MO-DKB-03141W | Rabbit Anti-MyD88 (AA 200-270) Antibody (Cat MO-DKB-03141W) |
MO-AB-42103W | Mouse Anti-Guinea pig Myd88 Antibody (MO-AB-42103W) |
MO-AB-16275R | Mouse Anti-Cattle MYD88 Antibody (MO-AB-16275R) |
MO-AB-16233Y | Mouse Anti-Sheep MYD88 Antibody (MO-AB-16233Y) |
MO-AB-59597W | Mouse Anti-Marmoset MYD88 Antibody (MO-AB-59597W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry