Cat: MO-AB-27438R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Pig (Sus scrofa) |
| Clone | MO27438R |
| Specificity | This antibody binds to Pig MYD88. |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | This product is a mouse antibody against MYD88. It can be used for MYD88 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Myeloid differentiation primary response gene 88, Fragment; MYD88 |
| UniProt ID | Q6T5D4 |
| Protein Refseq | The length of the protein is 42 amino acids long. The sequence is show below: ALSLSPGAHQKRLIPVKYKSMKKEFPSILRFITVCDYTNPCT. |
See other products for " MYD88 "
| MO-AB-59596W | Mouse Anti-Marmoset MYD88 Antibody (MO-AB-59596W) |
| MO-AB-45610W | Mouse Anti-Horse MYD88 Antibody (MO-AB-45610W) |
| MO-AB-12134Y | Mouse Anti-O. mykiss MYD88 Antibody (MO-AB-12134Y) |
| MO-AB-22782W | Mouse Anti-Chimpanzee MYD88 Antibody (MO-AB-22782W) |
| MO-AB-42103W | Mouse Anti-Guinea pig Myd88 Antibody (MO-AB-42103W) |
| MO-AB-23486H | Mouse Anti-Mallard MyD88 Antibody (MO-AB-23486H) |
| CBMOAB-25200FYA | Mouse Anti-D. melanogaster Myd88 Antibody (CBMOAB-25200FYA) |
| MO-AB-16233Y | Mouse Anti-Sheep MYD88 Antibody (MO-AB-16233Y) |
| MO-AB-35157W | Mouse Anti-Ferret MyD88 Antibody (MO-AB-35157W) |
| MO-AB-16232Y | Mouse Anti-Sheep MyD88 Antibody (MO-AB-16232Y) |
For Research Use Only | Not For Clinical Use.