Mouse Anti-Pig PRL Antibody (MO-AB-28579R)
Cat: MO-AB-28579R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO28579R |
Specificity | This antibody binds to Pig PRL. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Prolactin is a hormone released by the pituitary gland. The pituitary is a small gland at the base of the brain. It regulates the body''s balance of many hormones. Prolactin stimulates breast development and milk production in women. There is no known normal function for prolactin in men. |
Product Overview | This product is a mouse antibody against PRL. It can be used for PRL detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Prolactin, Fragment; PRL |
UniProt ID | B5A8N8 |
Protein Refseq | The length of the protein is 59 amino acids long. The sequence is show below: IKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC. |
See other products for " PRL "
MOFY-0622-FY52 | Rabbit Anti-PRL Antibody (MOFY-0622-FY52) |
MO-AB-28043H | Mouse Anti-Rat Prl Antibody (MO-AB-28043H) |
MO-AB-17239Y | Mouse Anti-Sheep PRL Antibody (MO-AB-17239Y) |
MO-AB-05363W | Mouse Anti-Rhesus PRL Antibody (MO-AB-05363W) |
MO-AB-03582Y | Mouse Anti-Chicken prl Antibody (MO-AB-03582Y) |
MOFY-0722-FY343 | Rabbit Anti-PRL Antibody (MOFY-0722-FY343) |
MO-AB-01192L | Mouse Anti-Elephant PRL Antibody (MO-AB-01192L) |
MOFY-0722-FY286 | Rabbit Anti-PRL Antibody (MOFY-0722-FY286) |
CBMOAB-93990FYA | Mouse Anti-Zebrafish prl Antibody (CBMOAB-93990FYA) |
MO-AB-01372R | Mouse Anti-Medaka prl Antibody (MO-AB-01372R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry