Mouse Anti-Rhesus PRL Antibody (MO-AB-05363W)


Cat: MO-AB-05363W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO05363W
SpecificityThis antibody binds to Rhesus PRL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProlactin is a hormone released by the pituitary gland. The pituitary is a small gland at the base of the brain. It regulates the body''s balance of many hormones. Prolactin stimulates breast development and milk production in women. There is no known normal function for prolactin in men.
Product OverviewMouse Anti-Rhesus PRL Antibody is a mouse antibody against PRL. It can be used for PRL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPRL
UniProt IDG7MQU0
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MNIKGSPWKAGSLLLLLVSNLLLCQNVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITRAINSCHTSSLPTPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMEEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWTGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC.
See other products for " PRL "
MOFY-0722-FY343Rabbit Anti-PRL Antibody (MOFY-0722-FY343)
MO-AB-38027WMouse Anti-Goat PRL Antibody (MO-AB-38027W)
MO-AB-32899WMouse Anti-Dog PRL Antibody (MO-AB-32899W)
MO-AB-23645HMouse Anti-Mallard PRL Antibody (MO-AB-23645H)
MO-AB-01192LMouse Anti-Elephant PRL Antibody (MO-AB-01192L)
MO-AB-03582YMouse Anti-Chicken prl Antibody (MO-AB-03582Y)
MO-AB-09533YMouse Anti-Rabbit PRL Antibody (MO-AB-09533Y)
MO-AB-62308WMouse Anti-Marmoset prl Antibody (MO-AB-62308W)
MO-AB-18511RMouse Anti-Cattle PRL Antibody (MO-AB-18511R)
MO-AB-46195WMouse Anti-Horse PRL Antibody (MO-AB-46195W)
For Research Use Only | Not For Clinical Use.
Online Inquiry