Mouse Anti-Pig RPL5 Antibody (MO-AB-28860R)
Cat: MO-AB-28860R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO28860R |
Specificity | This antibody binds to Pig RPL5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. As part of the 5S RNP/5S ribonucleoprotein particle it is an essential component of the LSU, required for its formation and the maturation of rRNAs. It also couples ribosome biogenesis to p53/TP53 activation. As part of the 5S RNP it accumulates in the nucleoplasm and inhibits MDM2, when ribosome biogenesis is perturbed, mediating the stabilization and the activation of TP53. Interacts with RRP1B. |
Product Overview | This product is a mouse antibody against RPL5. It can be used for RPL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 60S ribosomal protein L5; RPL5 |
UniProt ID | F1S530 |
Protein Refseq | The length of the protein is 297 amino acids long. The sequence is show below: MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHILGQNVADYMRYLIEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES. |
See other products for " RPL5 "
MO-AB-46369W | Mouse Anti-Horse RPL5 Antibody (MO-AB-46369W) |
CBMOAB-56774FYA | Mouse Anti-Rhesus RPL5 Antibody (CBMOAB-56774FYA) |
MO-AB-09760Y | Mouse Anti-Rabbit RPL5 Antibody (MO-AB-09760Y) |
MO-AB-28643W | Mouse Anti-Cucumber rpl5 Antibody (MO-AB-28643W) |
CBMOAB-40457FYC | Mouse Anti-Arabidopsis RPL5 Antibody (CBMOAB-40457FYC) |
MO-AB-49489W | Mouse Anti-Maize rpl5 Antibody (MO-AB-49489W) |
MO-AB-07257H | Mouse Anti-Frog rpl5 Antibody (MO-AB-07257H) |
CBMOAB-03553CR | Mouse Anti-Yeast RPL5 Antibody (CBMOAB-03553CR) |
MO-AB-19520R | Mouse Anti-Cattle RPL5 Antibody (MO-AB-19520R) |
MO-DKB-00394W | Rabbit Anti-RPL5 Antibody (MO-DKB-00394W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry