Rabbit Anti-RPL5 Antibody (MO-DKB-00394W)
Cat: MO-DKB-00394W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Rabbit (Oryctolagus cuniculus) |
Species Reactivity | Human (Homo sapiens), A. thaliana (Arabidopsis thaliana), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
Immunogen | Synthetic peptide corresponding to RPL5 (ribosomal protein L5) The peptide sequence is selected from the N-terminus of RPL5. Peptide sequence RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP. |
Format | Liquid or Lyophilized |
Buffer | PBS, 2% Sucrose |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | Affinity purified |
Application Information
Application | WB |
Application Notes | Western Blot 1.0 ug/ml |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of four RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18P family of ribosomal proteins and component of the 60S subunit. The encoded protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The encoded protein may also function to inhibit tumorigenesis through the activation of downstream tumor suppressors and the downregulation of oncoprotein expression. Mutations in this gene have been identified in patients with Diamond-Blackfan Anemia (DBA). This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. [provided by RefSeq, Mar 2017] |
Product Overview | This product is a Rabbit antibody against the RPL5. It can be used for RPL5 detection in Western Blot. |
Alternative Names | Ribosomal Protein L5; Protein Phosphatase 1, Regulatory Subunit 135; Large Ribosomal Subunit Protein UL18; 0S Ribosomal Protein L5; PPP1R135; MSTP030; L5; |
Gene ID | 6125 |
UniProt ID | P46777 |
See other products for " RPL5 "
MOFAB-248W | Arabidopsis RPL5 Antibody (MOFAB-248W) |
CBMOAB-56774FYA | Mouse Anti-Rhesus RPL5 Antibody (CBMOAB-56774FYA) |
MO-AB-19520R | Mouse Anti-Cattle RPL5 Antibody (MO-AB-19520R) |
MO-AB-63537W | Mouse Anti-Marmoset RPL5 Antibody (MO-AB-63537W) |
CBMOAB-40457FYC | Mouse Anti-Arabidopsis RPL5 Antibody (CBMOAB-40457FYC) |
MO-AB-28860R | Mouse Anti-Pig RPL5 Antibody (MO-AB-28860R) |
MO-AB-30513H | Mouse Anti-Sugar beet rpl5 Antibody (MO-AB-30513H) |
CBMOAB-89183FYB | Mouse Anti-Rice RPL5 Antibody (CBMOAB-89183FYB) |
MO-AB-28643W | Mouse Anti-Cucumber rpl5 Antibody (MO-AB-28643W) |
MO-AB-49489W | Mouse Anti-Maize rpl5 Antibody (MO-AB-49489W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry