Mouse Anti-Marmoset RPL5 Antibody (MO-AB-63537W)
Cat: MO-AB-63537W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Marmoset |
Clone | MO63537W |
Specificity | This antibody binds to Marmoset RPL5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of four RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18P family of ribosomal proteins and component of the 60S subunit. The encoded protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The encoded protein may also function to inhibit tumorigenesis through the activation of downstream tumor suppressors and the downregulation of oncoprotein expression. Mutations in this gene have been identified in patients with Diamond-Blackfan Anemia (DBA). This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. |
Product Overview | Mouse Anti-Marmoset RPL5 Antibody is a mouse antibody against RPL5. It can be used for RPL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ribosomal protein L5; Predicted; RPL5 |
UniProt ID | B0KWN5 |
Protein Refseq | The length of the protein is 297 amino acids long. The sequence is show below: MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNCAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDDQPGAFTCYLDAGFARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHMMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSITPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKTDRVAQKKASFLRAQERAAES. |
See other products for " RPL5 "
CBMOAB-03553CR | Mouse Anti-Yeast RPL5 Antibody (CBMOAB-03553CR) |
MO-AB-28860R | Mouse Anti-Pig RPL5 Antibody (MO-AB-28860R) |
MO-AB-46369W | Mouse Anti-Horse RPL5 Antibody (MO-AB-46369W) |
CBMOAB-89183FYB | Mouse Anti-Rice RPL5 Antibody (CBMOAB-89183FYB) |
CBMOAB-40457FYC | Mouse Anti-Arabidopsis RPL5 Antibody (CBMOAB-40457FYC) |
MO-DKB-00394W | Rabbit Anti-RPL5 Antibody (MO-DKB-00394W) |
CBMOAB-30034FYA | Mouse Anti-D. melanogaster Rpl5 Antibody (CBMOAB-30034FYA) |
CBMOAB-09328HCB | Mouse Anti-C. elegans RPL5 Antibody (CBMOAB-09328HCB) |
MO-AB-19520R | Mouse Anti-Cattle RPL5 Antibody (MO-AB-19520R) |
MO-AB-39474W | Mouse Anti-Grape rpl5 Antibody (MO-AB-39474W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry