AibGenesis™ Mouse Anti-PIP5KL1 Antibody (CBMOAB-54583FYA)


Cat: CBMOAB-54583FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54583FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO54583FYA 100 µg
CBMOAB-92692FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92692FYA 100 µg
MO-AB-10935W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10935W 100 µg
MO-AB-17953R Monoclonal Cattle (Bos taurus) WB, ELISA MO17953R 100 µg
MO-AB-27887H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27887C 100 µg
MO-AB-61568W Monoclonal Marmoset WB, ELISA MO61568W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO54583FYA
SpecificityThis antibody binds to Rhesus PIP5KL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PIP5KL1 Antibody is a mouse antibody against PIP5KL1. It can be used for PIP5KL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPIP5KL1
UniProt IDF6W075
Protein RefseqThe length of the protein is 207 amino acids long.
The sequence is show below: VSSHQVLAPSPEAGCRAVTSSRRGLLWRLRDKQSRLGLFEISPGHELHGMTCMMQAGLWAATQVSMDHPPTGPPSQDDFSEVLTQVHEGFELGTLAGPAFAWLRRSLGLAEDDYQAALGPGGPYLQFLSTSKSKASFFLSHDQRFFLKTQGRREVQALLAHLPRYVQHLQRHPHSLLARLLGVHSLRVDRGKKVGETKERWLGGAGG.
For Research Use Only | Not For Clinical Use.
Online Inquiry