AibGenesis™ Mouse Anti-PIRT Antibody (CBMOAB-54587FYA)


Cat: CBMOAB-54587FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54587FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO54587FYA 100 µg
MO-AB-27888H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27888C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO54587FYA
SpecificityThis antibody binds to Rhesus PIRT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PIRT Antibody is a mouse antibody against PIRT. It can be used for PIRT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPIRT
UniProt IDF7BQJ2
Protein RefseqThe length of the protein is 135 amino acids long.
The sequence is show below: METLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMSVGGAILLFGVVITCLAYTLKLSKNNLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKHRQKSTFLRSLKSFFLTR.
For Research Use Only | Not For Clinical Use.
Online Inquiry