AibGenesis™ Mouse Anti-pla2g12b Antibody (CBMOAB-92821FYA)


Cat: CBMOAB-92821FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-92821FYA Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO92821FYA 100 µg
MO-AB-27903H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27903C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO92821FYA
SpecificityThis antibody binds to Zebrafish pla2g12b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish pla2g12b Antibody is a mouse antibody against pla2g12b. It can be used for pla2g12b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPla2g12b protein; pla2g12
UniProt IDQ567L9
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MFPRALPLLLLCISAGLAATLIQASVDAASVDSPAGESPDVNQENQAEHVLMADAPVEGKPAPSATEESEDDDDWGFGSIRGSLQSVNGYFDSILELMGGRDGVCQFRCRYGKAPQPRPGYQMSEPDGCSTSLLGFQVPNSFDMGVPAMTKCCNQLDICYETCGSNKYRCDTKFRWCLHSICGDLKKSLGLMSKVEACETFADTMYNTVWTLGCRPFMNGQRASCYCEGEEKDEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry