AibGenesis™ Mouse Anti-PLK5 Antibody (MO-AB-18093R)


Cat: MO-AB-18093R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18093R Monoclonal Cattle (Bos taurus), Dog (Canis lupus familiaris), Pig (Sus scrofa) WB, ELISA MO18093R 100 µg
MO-AB-28397R Monoclonal Pig (Sus scrofa) WB, ELISA MO28397R 100 µg
MO-AB-32765W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32765W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Dog (Canis lupus familiaris), Pig (Sus scrofa)
CloneMO18093R
SpecificityThis antibody binds to Cattle PLK5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against PLK5. It can be used for PLK5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerine/threonine-protein kinase PLK; EC 2.7.11.21; Polo-like kinase; PLK5
UniProt IDE1BI47
Protein RefseqThe length of the protein is 600 amino acids long.
The sequence is show below: MDPRPRRRRRSCCPLVSVFLRDPSSGRVYRRGKLIGKGAFSRCYKLTDMSTSAVFALKVVPRGGGGAARLHARCKVEREIALHSRLRHRNIVAFHAHFADRDHVYMVLEYCSRQSLAHVLQARQTLTEPEVRYYLRGLVSGLSYLHQRRIVHRDLKLSNFFLNKNMEVKIGDLGLATKIGPGGRCHRVLCGTPNFLAPEVVSRNGHSCQSDIWALGCIMYMVLTGVPPFVAAPLSEMYQNIRDGRYPEPAHLSAN.
For Research Use Only | Not For Clinical Use.
Online Inquiry