AibGenesis™ Mouse Anti-plpbp Antibody (MO-AB-06334H)


Cat: MO-AB-06334H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06334H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO06334C 100 µg
MO-AB-18103R Monoclonal Cattle (Bos taurus) WB, ELISA MO18103R 100 µg
MO-AB-26586W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26586W 100 µg
MO-AB-61778W Monoclonal Marmoset WB, ELISA MO61778W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO06334C
SpecificityThis antibody binds to Frog plpbp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPyridoxal 5''-phosphate (PLP)-binding protein, which may be involved in intracellular homeostatic regulation of pyridoxal 5''-phosphate (PLP), the active form of vitamin B6. (From uniprot, under CC BY 4.0)
Product OverviewThis product is a mouse antibody against plpbp. It can be used for plpbp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC100037173 protein; prosc; LOC100037173
UniProt IDA2VD65
Protein RefseqThe length of the protein is 261 amino acids long.
The sequence is show below: MSEEIGKALQSVRERVQHAAARRIKTLPAIDPRLVAVSKTKPVDVVIEAYRHGQRYFGENYVQELAEKASDPSLLSSCPDIKWHFIGHLQKTHINKLVGVPNLYILETIDSVKLADKVNSSWQKKGSSEKLKVMVQVNTSSEDSKYGLAPAETAGLVKHIREKCPSLEFVGLMTIGSFGYDLTQGPNPDFQMLLAQRDMVCEKLGLQIDSVELSMGMSSDFEHAIEVGSTNVRIGSTLFGDRVYSKAVKEGANVTSTQNKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry