AibGenesis™ Mouse Anti-PLPP6 Antibody (MO-AB-18107R)


Cat: MO-AB-18107R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18107R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO18107R 100 µg
MO-AB-21920W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21920W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO18107R
SpecificityThis antibody binds to Cattle PLPP6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against PLPP6. It can be used for PLPP6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPresqualene diphosphate phosphatase; EC 3.1.3.-; Phosphatidic acid phosphatase type 2 domain-containing protein 2; PPAPDC2
UniProt IDQ58DI5
Protein RefseqThe length of the protein is 289 amino acids long.
The sequence is show below: MQSPRRNAEGRPLGTCDPSSSGSPAHGGGSRFEFQSLLSSRMPGADPTSARLRASESPVHRRGSFPLAGAGSSQALPPQLPEEDRIDLNPSFLGIALRSLLAIDLWLSKKLGVCAGESSSWGSMRPLMKLLEISGHGIPWLLGTLYCLSRSDSWAGREVLMNLLFALLLDLLLVSLIKGLVRRRRPAHNQMDMFFTISVDKYSFPSGHTTRAALVSRFILNHLVLAIPLRVLVVLWAFILGLSRVMLGRHNVTDV.
For Research Use Only | Not For Clinical Use.
Online Inquiry