AibGenesis™ Mouse Anti-pnliprp1 Antibody (MO-AB-06366H)


Cat: MO-AB-06366H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06366H Monoclonal Frog (Xenopus laevis), Cat (Felis catus), Dog (Canis lupus familiaris), Pig (Sus scrofa) WB, ELISA MO06366C 100 µg
MO-AB-08705W Monoclonal Cat (Felis catus) WB, ELISA MO08705W 100 µg
MO-AB-28416R Monoclonal Pig (Sus scrofa) WB, ELISA MO28416R 100 µg
MO-AB-32776W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32776W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cat (Felis catus), Dog (Canis lupus familiaris), Pig (Sus scrofa)
CloneMO06366C
SpecificityThis antibody binds to Frog pnliprp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against pnliprp1. It can be used for pnliprp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC83411 protein; pnliprp1; MGC83411
UniProt IDQ642R3
Protein RefseqThe length of the protein is 472 amino acids long.
The sequence is show below: MSGCWGLIFFLLGYVQAGKVCYDKIGCFTDDKPWSGTLERLIGRLPESPEHINTHLLMFTRENPDMFQELHSLNPSALPLTNFKTNRKSRFIIHGFLEQGEENWLVNMCKTMLKVEDVNCFCVDWSGGSRTLYSQAANNIRVVGAELAYFISFLSNNMNYSLSKVHVIGHSLGSHTAGEVGKRVPGIGRITGLDPAGPFFQDTPPEVRLDPTDALFVDVIHTDTSPLIPKMGYGMRQSVGHMDFFPNGGESMRGCNKPIVAKLLDIDGLWEGSRDIFACNHLRSYKYYTESITSPNGFIGYPSTSYGEFTKGNGFPCPSSGCPLMGHYADLFSGHGINEHSYFLNTGSEKPYSRWRYRVTVKTTGRLNFFGSIQVSLHGVKGSTTGQEIARRLIKPGQTYTAFIDVEADVGPLTTVSFSWNKSLIDIIPSKVGAEMISVQYGKDGQTYKFCGKDTVRAKSLQSLTSCSSATK.
For Research Use Only | Not For Clinical Use.
Online Inquiry