AibGenesis™ Mouse Anti-PNPLA4 Antibody (CBMOAB-54930FYA)


Cat: CBMOAB-54930FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-54930FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO54930FYA 100 µg
CBMOAB-93150FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93150FYA 100 µg
MO-AB-05248W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05248W 100 µg
MO-AB-06372H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06372C 100 µg
MO-AB-18167R Monoclonal Cattle (Bos taurus) WB, ELISA MO18167R 100 µg
MO-AB-19127W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19127W 100 µg
MO-AB-27954H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27954C 100 µg
MO-AB-28423R Monoclonal Pig (Sus scrofa) WB, ELISA MO28423R 100 µg
MO-AB-61860W Monoclonal Marmoset WB, ELISA MO61860W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO54930FYA
SpecificityThis antibody binds to Rhesus PNPLA4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PNPLA4 Antibody is a mouse antibody against PNPLA4. It can be used for PNPLA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPNPLA4
UniProt IDF7E9K3
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: MKHINLSFAACGFLGIYHLGAASALCRHGKKLLKDVKAFAGASAGSLVASVLLTAPEKIEECNQFTYKFAEEIRRQSFGAVTPGYDIMAQLRSGMESILPPNAHELAQNRLHVSITNTRTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKPVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMESLYQCGFDDTIKFLLKENWFE.
For Research Use Only | Not For Clinical Use.
Online Inquiry