AibGenesis™ Mouse Anti-pnrc1 Antibody (CBMOAB-93165FYA)


Cat: CBMOAB-93165FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-93165FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO93165FYA 100 µg
MO-AB-18170R Monoclonal Cattle (Bos taurus) WB, ELISA MO18170R 100 µg
MO-AB-25854W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25854W 100 µg
MO-AB-61870W Monoclonal Marmoset WB, ELISA MO61870W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO93165FYA
SpecificityThis antibody binds to Zebrafish pnrc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish pnrc1 Antibody is a mouse antibody against pnrc1. It can be used for pnrc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namespnrc1; si:dkey-77b17.2; NP_001076548.1
UniProt IDQ5TZ15
Protein RefseqThe length of the protein is 197 amino acids long.
The sequence is show below: MLGDAFGRRVESSVDNKAVKINRSKQVLLKKRGRNVHSKANNTSANIHRGSANEELKPAQSKPAPNKQQPKSCTAERGSQISRASILNCSRLEQTTDNLNRRTHQSKHQINARQDKPTSTEKSPENILKQGNASTSSDAEKTYAGAKFSEPPSPSVLPKPPRHWVGDHAPQHTHKHCSREQMSEHLKTLLKVQTDSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry