AibGenesis™ Mouse Anti-POLR2K Antibody (CBMOAB-54997FYA)
Cat: CBMOAB-54997FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-54997FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO54997FYA | 100 µg | ||
| CBMOAB-93279FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO93279FYA | 100 µg | ||
| MO-AB-06407H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06407C | 100 µg | ||
| MO-AB-15451W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15451W | 100 µg | ||
| MO-AB-18232R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO18232R | 100 µg | ||
| MO-AB-27969H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27969C | 100 µg | ||
| MO-AB-61950W | Monoclonal | Marmoset | WB, ELISA | MO61950W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO54997FYA |
| Specificity | This antibody binds to Rhesus POLR2K. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus POLR2K Antibody is a mouse antibody against POLR2K. It can be used for POLR2K detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | DNA-directed RNA polymerases I, II, and III subunit RPABC4; POLR2K |
| UniProt ID | H9F1K6 |
| Protein Refseq | The length of the protein is 54 amino acids long. The sequence is show below: MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry