AibGenesis™ Mouse Anti-PPAN-P2RY11 Antibody (MO-AB-05283W)


Cat: MO-AB-05283W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05283W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO05283W 100 µg
MO-AB-18299R Monoclonal Cattle (Bos taurus) WB, ELISA MO18299R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO05283W
SpecificityThis antibody binds to Rhesus PPAN-P2RY11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PPAN-P2RY11 Antibody is a mouse antibody against PPAN-P2RY11. It can be used for PPAN-P2RY11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPPAN-P2RY11
UniProt IDG7NKZ0
Protein RefseqThe length of the protein is 374 amino acids long.
The sequence is show below: MAANVSDAKSCPANFSAAADHILSGFQEDFLWPILVVQFLVALASNGLALYRFSTREQRPWYPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFTRSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGVGNCIVARPEACIKCLGTAGHRLEAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPSMTVAEKLRVAALVASGVALYASSYVPYHVMRVLNVDARRRWSTRCPSFADVAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYKDSWNPEDAKNTGQALPLNATAASKPSEPQSHELSP.
For Research Use Only | Not For Clinical Use.
Online Inquiry