AibGenesis™ Mouse Anti-PPAPDC3 Antibody (CBMOAB-55073FYA)


Cat: CBMOAB-55073FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55073FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55073FYA 100 µg
CBMOAB-93433FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93433FYA 100 µg
MO-AB-18301R Monoclonal Cattle (Bos taurus) WB, ELISA MO18301R 100 µg
MO-AB-62011W Monoclonal Marmoset WB, ELISA MO62011W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO55073FYA
SpecificityThis antibody binds to Rhesus PPAPDC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays a role as negative regulator of myoblast differentiation, in part through effects on MTOR signaling. Has no detectable enzymatic activity. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus PPAPDC3 Antibody is a mouse antibody against PPAPDC3. It can be used for PPAPDC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative lipid phosphate phosphatase PPAPDC3; PPAPDC3
UniProt IDH9G0X1
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASSPSAQPPPAGDGARERRQSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITGHGIPWIGGTILCLVKSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYEMSPSLLDYLTMDVYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWALCVGLSRVMIGRHHVTDVLSGFVIGYLQFRLVELVWMPSSTCQMLISAW.
For Research Use Only | Not For Clinical Use.
Online Inquiry