Mouse Anti-PPARGC1A Antibody (MO-AB-18306R)


Cat: MO-AB-18306R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18306R Monoclonal Cattle (Bos taurus), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO18306R 100 µg
CBMOAB-93458FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93458FYA 100 µg
CBMOAB-61296FYC Monoclonal Zebrafish (Danio rerio) WB, ELISA MO61296FYC 100 µg
MO-AB-38004W Monoclonal Goat (Capra hircus) WB, ELISA MO38004W 100 µg
MO-AB-62014W Monoclonal Marmoset WB, ELISA MO62014W 100 µg
MO-AB-28489R Monoclonal Pig (Sus scrofa) WB, ELISA MO28489R 100 µg
MO-AB-17184Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17184Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO18306R
SpecificityThis antibody binds to Cattle PPARGC1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis protein has nuclear receptor transcription coactivator activity and transcription coregulator activity, which can combine signaling receptor and transcription factor. It plays an important role in many biological processes, including brown fat cell differentiation, late distal convoluted tubule development, mitochondrion organization, positive regulation of DNA-binding transcription factor activity, positive regulation of transcription by RNA polymerase II, proximal straight tubule development and skeletal muscle tissue development.
Product OverviewThis product is a mouse antibody against PPARGC1A. It can be used for PPARGC1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPPARGC1A protein; Peroxisome proliferator-activated receptor gamma coactivator 1-alpha; PPARGC1A
UniProt IDB0JYK8
Protein RefseqThe length of the protein is 818 amino acids long.
The sequence is show below: MAWDMCNQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTENEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNPAVVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKKKAHTQSQTQHLQAKPTT.
See other products for " PPARGC1A "
For Research Use Only | Not For Clinical Use.
Online Inquiry