AibGenesis™ Mouse Anti-PPIL6 Antibody (CBMOAB-55107FYA)


Cat: CBMOAB-55107FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55107FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO55107FYA 100 µg
CBMOAB-93534FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93534FYA 100 µg
MO-AB-05303W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05303W 100 µg
MO-AB-06464H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06464C 100 µg
MO-AB-13414W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13414W 100 µg
MO-AB-18335R Monoclonal Cattle (Bos taurus) WB, ELISA MO18335R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO55107FYA
SpecificityThis antibody binds to Rhesus PPIL6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus PPIL6 Antibody is a mouse antibody against PPIL6. It can be used for PPIL6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPPIL6
UniProt IDF7EAS2
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: RPLQVKVVGLFSCPNFQIAKSAAEELKNETWEYSSSVMSFVNGQFLGDALGLQKWAHEVWDIVDIKPSALYDALTEDFSTKFLRDTKHDFVFLDICIDSSPIGRLIFELYCDVCPKTCKNFQVLCTGKAGFSQRGIRLHYKDSIFHRIVRNGWIQGGDIVYGKGDNGESIYGPTFE.
For Research Use Only | Not For Clinical Use.
Online Inquiry