AibGenesis™ Mouse Anti-ppp1r35 Antibody (CBMOAB-93637FYA)


Cat: CBMOAB-93637FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-93637FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO93637FYA 100 µg
MO-AB-18368R Monoclonal Cattle (Bos taurus) WB, ELISA MO18368R 100 µg
MO-AB-20594W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20594W 100 µg
MO-AB-62119W Monoclonal Marmoset WB, ELISA MO62119W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO93637FYA
SpecificityThis antibody binds to Zebrafish ppp1r35.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ppp1r35 Antibody is a mouse antibody against ppp1r35. It can be used for ppp1r35 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein phosphatase 1 regulatory subunit 35; ppp1r3
UniProt IDQ0P427
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: MEVCGEPLIRAAPEPLRDERIQTAELLCADLDLSVSLTPERPADRRRRQVRFNVDPVLITVNPEPRNNQPTARKPPNKDEHGVETDREQSRECDGQQTHEAELNTTLALRAELEEEAEQTFDAEKAVREKLQSSTLTKNHVNSKAAEGLNFPRSQQLYRALVSVSLSRDQLISQALQDRPALAPPTASQNNKFSSPPPEGPDILQFYSPDKMLRETPLLPGDHIPLPRPRPVPRPAHTTFHLHRLHKLWES.
For Research Use Only | Not For Clinical Use.
Online Inquiry