AibGenesis™ Mouse Anti-PPP1R3B Antibody (CBMOAB-55189FYA)
Cat: CBMOAB-55189FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-55189FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Zebrafish (Danio rerio) | WB, ELISA | MO55189FYA | 100 µg | ||
| CBMOAB-93645FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO93645FYA | 100 µg | ||
| MO-AB-01166L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01166L | 100 µg | ||
| MO-AB-08131W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08131W | 100 µg | ||
| MO-AB-18370R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO18370R | 100 µg | ||
| MO-AB-20470W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20470W | 100 µg | ||
| MO-AB-28516R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28516R | 100 µg | ||
| MO-AB-32857W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO32857W | 100 µg | ||
| MO-AB-33663H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33663C | 100 µg | ||
| MO-AB-35500W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35500W | 100 µg | ||
| MO-AB-38012W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38012W | 100 µg | ||
| MO-AB-46150W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46150W | 100 µg | ||
| MO-AB-62122W | Monoclonal | Marmoset | WB, ELISA | MO62122W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Zebrafish (Danio rerio) |
| Clone | MO55189FYA |
| Specificity | This antibody binds to Rhesus PPP1R3B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Rhesus PPP1R3B Antibody is a mouse antibody against PPP1R3B. It can be used for PPP1R3B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein phosphatase 1 regulatory subunit 3; PPP1R3B |
| UniProt ID | H9ZDK5 |
| Protein Refseq | The length of the protein is 285 amino acids long. The sequence is show below: MMAVDIEYRYGCMAPSLRRERFAFKISPKPSKPLRPCIQLSSKKEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDEPLDITFNITELLDSIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDRAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYTGSDRDTFSFHISLPEKIQSYERMEFAVYYECNGQTHWDSNRGKNYRIIRAELKSTQGTTKPHNGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry