AibGenesis™ Mouse Anti-PPTC7 Antibody (CBMOAB-55256FYA)


Cat: CBMOAB-55256FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55256FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55256FYA 100 µg
CBMOAB-93758FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93758FYA 100 µg
MO-AB-17322W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17322W 100 µg
MO-AB-62199W Monoclonal Marmoset WB, ELISA MO62199W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO55256FYA
SpecificityThis antibody binds to Rhesus PPTC7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProtein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q. Dephosphorylates the ubiquinone biosynthesis protein coq7 which is likely to lead to its activation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus PPTC7 Antibody is a mouse antibody against PPTC7. It can be used for PPTC7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPPTC7
UniProt IDF6Z829
Protein RefseqThe length of the protein is 304 amino acids long.
The sequence is show below: MFSVLSYGRLVARAVLGGLSQTDPRAGGGGGGDYGLVTAGCGFGKDFRKGLLKKGACYGDDACFVARHRSADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPIGILTTSYCELLQNKVPLLGNSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQLGDIILTATDGLFDNMPDYMILQELKKLKNPNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEYTD.
For Research Use Only | Not For Clinical Use.
Online Inquiry